PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV35152.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 836aa    MW: 92808.8 Da    PI: 6.5534
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV35152.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.1e-23205306199
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + ++++l+
  KZV35152.1 205 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIGKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGEDGNLR 300
                 99****************************86333.34679************************************************..449999** PP

                 EEEE-S CS
          B3  94 vkvfrk 99 
                 ++++r+
  KZV35152.1 301 LGIRRA 306
                 ***996 PP

2Auxin_resp110.81.4e-36331412182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +a+a+s++++F+v+Y+Pras+++F+++ ek++k +++++ +G Rfkm+f+ +ds+err+sG+v+gvsd+dp+rWpnSkWrsL
  KZV35152.1 331 VANALSSNTTFHVFYSPRASHADFIIPHEKYVKCVRCQIPIGLRFKMKFDLDDSPERRFSGVVTGVSDMDPYRWPNSKWRSL 412
                 689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-42201318IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.8E-39202318IPR015300DNA-binding pseudobarrel domain
CDDcd100173.86E-21203305No hitNo description
SMARTSM010193.7E-22205307IPR003340B3 DNA binding domain
PROSITE profilePS5086312.788205307IPR003340B3 DNA binding domain
PfamPF023623.5E-21205306IPR003340B3 DNA binding domain
PfamPF065071.2E-30331412IPR010525Auxin response factor
SuperFamilySSF542773.58E-11711791No hitNo description
PROSITE profilePS5174521.909712794IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 836 aa     Download sequence    Send to blast
MEIDLNHALN ETEKNICDEN GGKCDTGGFG GCLQRCLSTS TSSCSSNAAS GSSFPSSESP  60
KSSLYTELWH ACAGPLISLP DKGSVVVYFA QGHMEQAASS LPFPPLELPT FDLPPQIFCR  120
VVDVQLLANK ENDEVYTQLT LLPLQEVRMI GVAIAFMLDY FLRFYVLVFL KVLVGQKLEG  180
KEKESAGVEG DENGASPLKL TSHMFCKTLT ASDTSTHGGF SVPRRAAEDC FPPLDYKEQR  240
PSQELIGKDL HGVEWKFRHI YRGQPRRHLL TTGWSIFVSQ KNLVSGDAVL FLRGEDGNLR  300
LGIRRAARPR NGLPDSIIKS QNSYPNVLSS VANALSSNTT FHVFYSPRAS HADFIIPHEK  360
YVKCVRCQIP IGLRFKMKFD LDDSPERRFS GVVTGVSDMD PYRWPNSKWR SLTVRWDDDI  420
VINGQERVSP WDIEFPGNSA PLSIQSTPRI KKLRSSLLAT PVGGPIVGGG ARFDFGESVR  480
SSKVLQGQEN ETLASPGYGN DGINHQLDFV THPAATNPIP NRMGKLSYTE FVRYQALSSF  540
TGFQQSNWST EVLQGQEICS PRSIAGKNDS NLGAWLKPEL GGHIFNDQQR RPCFYPLASE  600
GSRRMLFPQK GVYRARQGPF MLSNFSNIQT GDRPLNPTSI LTRTSREMGY VPLLSNERRA  660
AEVISAPSNS TMHLKNVSDE NMFKDKVPIC KLFGFSLTED HVSANSQGPS KRSCTKVHKQ  720
GSLVGRAIDL TRLQGYDDLL TELERLFSMD GLLRDPNNGW RILYTDSEND MMVVGDDPWH  780
EFIEVVSKIH IYTREEVEKL SIGINSDDTQ SCLEEAPPTT DASGGQLDSS ATLVEM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1166343918357Auxin response factor 1
4ldw_A1e-1166343918357Auxin response factor 1
4ldw_B1e-1166343918357Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089883.10.0PREDICTED: auxin response factor 4 isoform X1
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLQ2LAI90.0Q2LAI9_SOLLC; Auxin response factor
STRINGSolyc11g069190.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51432234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4